Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HBP7

Protein Details
Accession A0A2I1HBP7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
84-104GYWSEKPPKRHIRKVATSSNQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045379  Crinkler_N  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF20147  Crinkler  
Amino Acid Sequences MSITLLCFVKGNTLANAFPVDVEKDQLVGRLKKVIKAEKQNKFASVDADKFRLWKVEISVDRERSVEQSLLRDKDELLAKRDIGYWSEKPPKRHIRKVATSSNQQAFSTLLNKQLPSNIPVNQQNYGFTDFKFKGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.16
5 0.14
6 0.14
7 0.15
8 0.12
9 0.14
10 0.13
11 0.13
12 0.13
13 0.17
14 0.22
15 0.21
16 0.22
17 0.29
18 0.3
19 0.33
20 0.39
21 0.43
22 0.45
23 0.54
24 0.63
25 0.63
26 0.7
27 0.67
28 0.63
29 0.57
30 0.5
31 0.43
32 0.37
33 0.33
34 0.28
35 0.28
36 0.26
37 0.24
38 0.23
39 0.21
40 0.18
41 0.15
42 0.15
43 0.2
44 0.23
45 0.29
46 0.33
47 0.32
48 0.32
49 0.31
50 0.29
51 0.23
52 0.22
53 0.17
54 0.12
55 0.15
56 0.18
57 0.19
58 0.19
59 0.18
60 0.16
61 0.19
62 0.24
63 0.21
64 0.21
65 0.21
66 0.21
67 0.21
68 0.23
69 0.2
70 0.16
71 0.2
72 0.18
73 0.24
74 0.34
75 0.37
76 0.39
77 0.49
78 0.58
79 0.62
80 0.69
81 0.72
82 0.72
83 0.77
84 0.81
85 0.81
86 0.76
87 0.73
88 0.71
89 0.67
90 0.59
91 0.49
92 0.42
93 0.33
94 0.29
95 0.26
96 0.2
97 0.21
98 0.21
99 0.22
100 0.22
101 0.26
102 0.27
103 0.27
104 0.3
105 0.27
106 0.32
107 0.38
108 0.4
109 0.38
110 0.37
111 0.35
112 0.35
113 0.37
114 0.32
115 0.26
116 0.31