Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GWH6

Protein Details
Accession A0A2I1GWH6   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-106IVNKGNNKIKKQKTEKHLEKLEKNNNKIHydrophilic
NLS Segment(s)
PositionSequence
62-74GKMILKKRKIKEI
82-92KGNNKIKKQKT
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MNRAWEIVRGVYNTNFNKLSNKKESKEVVKKLWNFINEEIKRRIWIKRCEDIAELEKKEGLGKMILKKRKIKEISEGTIVNKGNNKIKKQKTEKHLEKLEKNNNKIISLVTIPKLANIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.3
4 0.37
5 0.39
6 0.45
7 0.47
8 0.53
9 0.5
10 0.56
11 0.62
12 0.64
13 0.69
14 0.67
15 0.65
16 0.66
17 0.66
18 0.64
19 0.62
20 0.53
21 0.47
22 0.45
23 0.47
24 0.41
25 0.44
26 0.41
27 0.37
28 0.38
29 0.37
30 0.39
31 0.37
32 0.44
33 0.45
34 0.49
35 0.5
36 0.5
37 0.48
38 0.45
39 0.42
40 0.38
41 0.32
42 0.25
43 0.23
44 0.2
45 0.2
46 0.17
47 0.12
48 0.08
49 0.11
50 0.18
51 0.25
52 0.3
53 0.35
54 0.42
55 0.45
56 0.52
57 0.54
58 0.49
59 0.52
60 0.54
61 0.52
62 0.49
63 0.47
64 0.38
65 0.39
66 0.37
67 0.29
68 0.25
69 0.25
70 0.29
71 0.34
72 0.4
73 0.45
74 0.53
75 0.62
76 0.68
77 0.73
78 0.75
79 0.8
80 0.82
81 0.82
82 0.83
83 0.81
84 0.8
85 0.81
86 0.82
87 0.8
88 0.75
89 0.73
90 0.65
91 0.57
92 0.5
93 0.41
94 0.34
95 0.29
96 0.29
97 0.24
98 0.26
99 0.25