Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GM84

Protein Details
Accession A0A2I1GM84   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-105GKTWENKEERRERKRREGLARQIGLBasic
NLS Segment(s)
PositionSequence
89-99ERRERKRREGL
Subcellular Location(s) nucl 14.5, mito_nucl 12.833, mito 10, cyto_mito 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR003827  tRNA_yW-synthesising  
IPR036602  tRNA_yW-synthesising-like_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF02676  TYW3  
Amino Acid Sequences MVVIRSSLKLDTPIARLDSTNHKLYLFVDLSYLYLLVTLSNQKFDENSRRMKELYKKLEDHLFTGIGSGEDGITKCTKEIGKTWENKEERRERKRREGLARQIGLRKSGTLSDGNDGDVSTVDDESQGLDNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.25
4 0.26
5 0.32
6 0.33
7 0.35
8 0.32
9 0.29
10 0.29
11 0.29
12 0.33
13 0.24
14 0.19
15 0.15
16 0.15
17 0.15
18 0.14
19 0.14
20 0.06
21 0.05
22 0.05
23 0.04
24 0.06
25 0.11
26 0.11
27 0.14
28 0.14
29 0.14
30 0.15
31 0.2
32 0.28
33 0.27
34 0.35
35 0.35
36 0.37
37 0.38
38 0.43
39 0.48
40 0.48
41 0.51
42 0.49
43 0.48
44 0.48
45 0.53
46 0.47
47 0.39
48 0.31
49 0.23
50 0.16
51 0.15
52 0.13
53 0.07
54 0.07
55 0.05
56 0.04
57 0.04
58 0.04
59 0.06
60 0.06
61 0.06
62 0.06
63 0.09
64 0.1
65 0.11
66 0.15
67 0.21
68 0.28
69 0.34
70 0.38
71 0.44
72 0.47
73 0.49
74 0.54
75 0.57
76 0.6
77 0.64
78 0.71
79 0.7
80 0.77
81 0.83
82 0.83
83 0.83
84 0.84
85 0.83
86 0.83
87 0.78
88 0.71
89 0.68
90 0.6
91 0.52
92 0.43
93 0.33
94 0.25
95 0.23
96 0.22
97 0.2
98 0.2
99 0.21
100 0.21
101 0.21
102 0.2
103 0.18
104 0.16
105 0.13
106 0.12
107 0.09
108 0.09
109 0.08
110 0.08
111 0.08
112 0.09