Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H3G1

Protein Details
Accession A0A2I1H3G1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
108-134GSSVQKRSRLCQKCKQPGHYAPRCPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MPDIMQMQGPKQKYGFGMGYAKKALDYAVRADKVEEFVTQLKVFIEEIKEDLSDQQDSVENMVIGDPLRTQHKGRQPNRYKSGGEVTKKSQKRKLQAMQDVTNTIEQGSSVQKRSRLCQKCKQPGHYAPRCPNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.26
4 0.33
5 0.32
6 0.35
7 0.33
8 0.32
9 0.26
10 0.24
11 0.21
12 0.16
13 0.16
14 0.17
15 0.24
16 0.25
17 0.25
18 0.26
19 0.26
20 0.25
21 0.24
22 0.19
23 0.14
24 0.15
25 0.18
26 0.16
27 0.16
28 0.14
29 0.13
30 0.13
31 0.12
32 0.11
33 0.09
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.11
40 0.1
41 0.09
42 0.09
43 0.1
44 0.1
45 0.1
46 0.1
47 0.08
48 0.07
49 0.07
50 0.07
51 0.05
52 0.05
53 0.04
54 0.05
55 0.08
56 0.1
57 0.11
58 0.17
59 0.25
60 0.35
61 0.41
62 0.51
63 0.58
64 0.66
65 0.71
66 0.69
67 0.62
68 0.54
69 0.58
70 0.54
71 0.48
72 0.42
73 0.42
74 0.47
75 0.52
76 0.56
77 0.55
78 0.56
79 0.6
80 0.66
81 0.69
82 0.69
83 0.72
84 0.73
85 0.68
86 0.63
87 0.56
88 0.47
89 0.4
90 0.3
91 0.21
92 0.14
93 0.1
94 0.09
95 0.15
96 0.18
97 0.22
98 0.25
99 0.29
100 0.32
101 0.4
102 0.49
103 0.52
104 0.57
105 0.62
106 0.7
107 0.77
108 0.83
109 0.84
110 0.83
111 0.83
112 0.85
113 0.85
114 0.84