Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8U0C1

Protein Details
Accession J8U0C1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
56-78LATIQRAKRKRLKIRCYGYKKLSHydrophilic
NLS Segment(s)
PositionSequence
63-66KRKR
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences KAFKTKIILGPYKRTPGDTNILAFKKPVTCFKYGQLNYIAIACKIRTNNPKTPLALATIQRAKRKRLKIRCYGYKKLSHIRPACFKKSKILLPNSIPLFGRLSTGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.45
4 0.46
5 0.4
6 0.37
7 0.37
8 0.38
9 0.34
10 0.31
11 0.28
12 0.27
13 0.27
14 0.33
15 0.29
16 0.32
17 0.33
18 0.38
19 0.46
20 0.41
21 0.42
22 0.36
23 0.32
24 0.28
25 0.29
26 0.25
27 0.14
28 0.15
29 0.12
30 0.12
31 0.13
32 0.19
33 0.26
34 0.32
35 0.39
36 0.42
37 0.45
38 0.43
39 0.43
40 0.37
41 0.31
42 0.28
43 0.22
44 0.23
45 0.26
46 0.29
47 0.33
48 0.35
49 0.4
50 0.45
51 0.54
52 0.59
53 0.64
54 0.7
55 0.74
56 0.81
57 0.85
58 0.85
59 0.83
60 0.79
61 0.76
62 0.73
63 0.72
64 0.69
65 0.68
66 0.65
67 0.63
68 0.66
69 0.66
70 0.7
71 0.68
72 0.63
73 0.61
74 0.63
75 0.65
76 0.64
77 0.63
78 0.61
79 0.59
80 0.66
81 0.58
82 0.54
83 0.46
84 0.39
85 0.34
86 0.27