Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FVV5

Protein Details
Accession A0A2I1FVV5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
121-150LRSNEHSRYHHKEKRKQLIKNNNFDRNKRKBasic
NLS Segment(s)
PositionSequence
133-137EKRKQ
146-150RNKRK
Subcellular Location(s) mito_nucl 12.499, nucl 12, mito 11.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MTISHDKSHVYYFKSARPPNFLKMIKFPSKLRVSCFYKANNKKFCPFLLSYTSNYSTVFILKASNLKSQQQIQRTPSSVPAGTILKGLNFYKDGADPIALPDDEYPNWLWEILDKEKDEQLRSNEHSRYHHKEKRKQLIKNNNFDRNKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.53
4 0.57
5 0.58
6 0.56
7 0.62
8 0.57
9 0.51
10 0.53
11 0.57
12 0.56
13 0.55
14 0.52
15 0.52
16 0.57
17 0.55
18 0.53
19 0.53
20 0.52
21 0.53
22 0.56
23 0.54
24 0.56
25 0.64
26 0.68
27 0.68
28 0.65
29 0.64
30 0.62
31 0.56
32 0.51
33 0.43
34 0.38
35 0.35
36 0.34
37 0.33
38 0.34
39 0.35
40 0.29
41 0.28
42 0.24
43 0.18
44 0.16
45 0.13
46 0.09
47 0.08
48 0.08
49 0.11
50 0.13
51 0.17
52 0.18
53 0.2
54 0.22
55 0.28
56 0.32
57 0.34
58 0.37
59 0.36
60 0.37
61 0.37
62 0.35
63 0.31
64 0.29
65 0.23
66 0.19
67 0.18
68 0.15
69 0.13
70 0.14
71 0.11
72 0.09
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.1
79 0.11
80 0.11
81 0.1
82 0.1
83 0.09
84 0.09
85 0.11
86 0.09
87 0.09
88 0.09
89 0.11
90 0.11
91 0.13
92 0.12
93 0.11
94 0.12
95 0.11
96 0.1
97 0.1
98 0.16
99 0.18
100 0.21
101 0.21
102 0.23
103 0.27
104 0.3
105 0.3
106 0.3
107 0.3
108 0.33
109 0.38
110 0.43
111 0.43
112 0.44
113 0.49
114 0.52
115 0.58
116 0.61
117 0.64
118 0.67
119 0.73
120 0.8
121 0.84
122 0.85
123 0.85
124 0.85
125 0.89
126 0.88
127 0.89
128 0.88
129 0.87
130 0.85