Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FT23

Protein Details
Accession A0A2I1FT23    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-74TVKRRGRIFVLCKKNKKHKQRQGBasic
NLS Segment(s)
PositionSequence
64-72KKNKKHKQR
Subcellular Location(s) mito 19.5, cyto_mito 11, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSLLTQISRTTFLPSRVSFTMSQPLLLFNSFNFIRGMKVRSSVKKFCDGCYTVKRRGRIFVLCKKNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.33
4 0.36
5 0.31
6 0.3
7 0.34
8 0.27
9 0.27
10 0.22
11 0.22
12 0.2
13 0.19
14 0.16
15 0.08
16 0.12
17 0.11
18 0.12
19 0.11
20 0.11
21 0.12
22 0.14
23 0.16
24 0.12
25 0.17
26 0.21
27 0.28
28 0.34
29 0.38
30 0.38
31 0.45
32 0.46
33 0.43
34 0.46
35 0.41
36 0.41
37 0.46
38 0.49
39 0.49
40 0.53
41 0.56
42 0.51
43 0.55
44 0.54
45 0.53
46 0.56
47 0.57
48 0.63
49 0.68
50 0.75
51 0.79
52 0.85
53 0.86
54 0.89