Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GK86

Protein Details
Accession A0A2I1GK86    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-70MKSKLDAKSKNKNKNKNEAHEKRBasic
146-165SLDNSDKYNNRYRSRRYRPYHydrophilic
NLS Segment(s)
PositionSequence
54-74AKSKNKNKNKNEAHEKREKRD
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR039875  LENG1-like  
Amino Acid Sequences MYLGDVVKEQKPWYTRVESEFEKQYKEERMNRYKDEGTTTIGDPLLTMKSKLDAKSKNKNKNKNEAHEKREKRDRSSNGSNSEALSTSSIEKLRAERLAREKKEHLRVQKLLNPNLVAESGSTGRYNSQFNPDATKAAHELSELSSLDNSDKYNNRYRSRRYRPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.39
4 0.44
5 0.42
6 0.45
7 0.5
8 0.46
9 0.42
10 0.39
11 0.4
12 0.41
13 0.45
14 0.48
15 0.49
16 0.57
17 0.61
18 0.64
19 0.65
20 0.6
21 0.54
22 0.51
23 0.43
24 0.37
25 0.33
26 0.3
27 0.26
28 0.23
29 0.21
30 0.15
31 0.14
32 0.13
33 0.11
34 0.11
35 0.09
36 0.13
37 0.17
38 0.2
39 0.27
40 0.33
41 0.4
42 0.51
43 0.61
44 0.67
45 0.73
46 0.8
47 0.79
48 0.81
49 0.82
50 0.81
51 0.82
52 0.8
53 0.78
54 0.78
55 0.75
56 0.72
57 0.73
58 0.67
59 0.63
60 0.64
61 0.62
62 0.6
63 0.65
64 0.63
65 0.57
66 0.55
67 0.49
68 0.4
69 0.35
70 0.27
71 0.18
72 0.13
73 0.09
74 0.08
75 0.1
76 0.1
77 0.1
78 0.1
79 0.11
80 0.13
81 0.17
82 0.17
83 0.21
84 0.3
85 0.4
86 0.41
87 0.45
88 0.49
89 0.52
90 0.61
91 0.62
92 0.59
93 0.58
94 0.59
95 0.59
96 0.59
97 0.59
98 0.53
99 0.5
100 0.43
101 0.35
102 0.31
103 0.26
104 0.2
105 0.13
106 0.12
107 0.1
108 0.1
109 0.1
110 0.1
111 0.12
112 0.14
113 0.17
114 0.16
115 0.22
116 0.25
117 0.26
118 0.33
119 0.32
120 0.32
121 0.3
122 0.3
123 0.25
124 0.21
125 0.21
126 0.14
127 0.14
128 0.14
129 0.17
130 0.15
131 0.14
132 0.14
133 0.14
134 0.16
135 0.16
136 0.15
137 0.18
138 0.24
139 0.28
140 0.38
141 0.46
142 0.54
143 0.61
144 0.71
145 0.75