Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1F4C4

Protein Details
Accession A0A2I1F4C4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
119-145VWYGRLKEKQYHKRWNKKRKNLAELPDHydrophilic
NLS Segment(s)
PositionSequence
129-138YHKRWNKKRK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MPPIVDSINKSHNNRHNPIYPSAILDQVKKLGKELLESSLGPIVQQPIVIPRAIIPSISQRLEPPNPFPGAFPTLTPFQKQQLRKYLNCWKNRKIMQNNKEKLAEEKFNLYLKRRAIYVWYGRLKEKQYHKRWNKKRKNLAELPDNFRPHSILKLSDKTSKSSRKVFRFCQTDKIYSYDPENDDQIRYIEIIGGKNYVYNEEIRKEVKRVLGIGNFYEEKYLYKAKTTKVWKMAFEQYREGKHADQQILKKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.64
4 0.61
5 0.62
6 0.58
7 0.5
8 0.45
9 0.42
10 0.41
11 0.35
12 0.32
13 0.3
14 0.31
15 0.34
16 0.3
17 0.3
18 0.27
19 0.26
20 0.28
21 0.28
22 0.25
23 0.24
24 0.24
25 0.24
26 0.22
27 0.21
28 0.17
29 0.16
30 0.15
31 0.12
32 0.12
33 0.11
34 0.13
35 0.14
36 0.14
37 0.13
38 0.12
39 0.16
40 0.16
41 0.15
42 0.13
43 0.19
44 0.24
45 0.25
46 0.24
47 0.22
48 0.29
49 0.34
50 0.36
51 0.32
52 0.32
53 0.33
54 0.33
55 0.31
56 0.29
57 0.27
58 0.25
59 0.21
60 0.19
61 0.23
62 0.23
63 0.25
64 0.22
65 0.25
66 0.32
67 0.36
68 0.41
69 0.46
70 0.52
71 0.51
72 0.58
73 0.62
74 0.62
75 0.67
76 0.67
77 0.62
78 0.64
79 0.69
80 0.71
81 0.71
82 0.74
83 0.74
84 0.77
85 0.74
86 0.69
87 0.65
88 0.56
89 0.49
90 0.43
91 0.37
92 0.28
93 0.27
94 0.26
95 0.27
96 0.29
97 0.28
98 0.28
99 0.26
100 0.26
101 0.23
102 0.21
103 0.2
104 0.24
105 0.25
106 0.29
107 0.31
108 0.32
109 0.33
110 0.37
111 0.37
112 0.38
113 0.43
114 0.46
115 0.51
116 0.6
117 0.69
118 0.76
119 0.84
120 0.89
121 0.89
122 0.89
123 0.9
124 0.89
125 0.88
126 0.84
127 0.79
128 0.77
129 0.72
130 0.68
131 0.64
132 0.56
133 0.47
134 0.4
135 0.35
136 0.27
137 0.25
138 0.2
139 0.18
140 0.21
141 0.26
142 0.29
143 0.35
144 0.35
145 0.36
146 0.42
147 0.46
148 0.47
149 0.51
150 0.57
151 0.59
152 0.65
153 0.67
154 0.68
155 0.68
156 0.65
157 0.66
158 0.62
159 0.56
160 0.51
161 0.49
162 0.42
163 0.34
164 0.36
165 0.31
166 0.28
167 0.26
168 0.27
169 0.24
170 0.22
171 0.22
172 0.19
173 0.14
174 0.13
175 0.11
176 0.11
177 0.12
178 0.12
179 0.12
180 0.12
181 0.12
182 0.13
183 0.13
184 0.13
185 0.12
186 0.14
187 0.17
188 0.18
189 0.22
190 0.23
191 0.26
192 0.27
193 0.3
194 0.3
195 0.29
196 0.3
197 0.32
198 0.33
199 0.33
200 0.31
201 0.32
202 0.29
203 0.26
204 0.25
205 0.2
206 0.17
207 0.2
208 0.24
209 0.2
210 0.27
211 0.31
212 0.34
213 0.42
214 0.49
215 0.53
216 0.57
217 0.61
218 0.56
219 0.58
220 0.64
221 0.62
222 0.59
223 0.58
224 0.55
225 0.55
226 0.54
227 0.52
228 0.44
229 0.43
230 0.47
231 0.46
232 0.47
233 0.49