Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GBU9

Protein Details
Accession A0A2I1GBU9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGNGKQILQRKIKNQRKRFAQLLFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 6, E.R. 5, golg 5, mito 4, pero 3, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR007527  Znf_SWIM  
IPR039903  Zswim2  
Gene Ontology GO:0016020  C:membrane  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF04434  SWIM  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
PS50966  ZF_SWIM  
CDD cd16494  RING-CH-C4HC3_ZSWM2  
Amino Acid Sequences MGNGKQILQRKIKNQRKRFAQLLFMSVLFIYTVTIKHVPNCTCPDFGKGNLCKHIFFIYLKVFRLNRDSSFIYQKALLSKELRSIFANAAPDPTVLANQSVRDKYKTFTSGELVSDTNGNENEKRRPIEGNCPICYEPLEEKDHKNIVWCKEGCGNNLHKDCFEQWKRSKRGDKVTCVYCRINWEESGSELLINEEGYVNLGDVQGMNTIRDTTSYYRKYRSWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.86
5 0.83
6 0.77
7 0.76
8 0.67
9 0.61
10 0.53
11 0.43
12 0.36
13 0.28
14 0.23
15 0.14
16 0.11
17 0.08
18 0.06
19 0.07
20 0.1
21 0.14
22 0.14
23 0.19
24 0.26
25 0.27
26 0.32
27 0.38
28 0.38
29 0.37
30 0.38
31 0.39
32 0.35
33 0.35
34 0.39
35 0.38
36 0.4
37 0.45
38 0.45
39 0.4
40 0.39
41 0.38
42 0.31
43 0.26
44 0.25
45 0.26
46 0.28
47 0.28
48 0.31
49 0.3
50 0.29
51 0.34
52 0.33
53 0.27
54 0.29
55 0.31
56 0.29
57 0.35
58 0.33
59 0.29
60 0.27
61 0.26
62 0.25
63 0.23
64 0.23
65 0.19
66 0.19
67 0.24
68 0.24
69 0.25
70 0.22
71 0.23
72 0.2
73 0.21
74 0.22
75 0.15
76 0.15
77 0.14
78 0.12
79 0.11
80 0.1
81 0.08
82 0.07
83 0.08
84 0.07
85 0.09
86 0.12
87 0.14
88 0.16
89 0.18
90 0.18
91 0.18
92 0.22
93 0.23
94 0.21
95 0.2
96 0.21
97 0.2
98 0.19
99 0.19
100 0.15
101 0.12
102 0.12
103 0.1
104 0.09
105 0.09
106 0.09
107 0.1
108 0.13
109 0.17
110 0.2
111 0.22
112 0.22
113 0.26
114 0.27
115 0.35
116 0.42
117 0.43
118 0.4
119 0.42
120 0.41
121 0.37
122 0.35
123 0.28
124 0.22
125 0.2
126 0.24
127 0.23
128 0.25
129 0.29
130 0.31
131 0.27
132 0.31
133 0.32
134 0.31
135 0.37
136 0.35
137 0.33
138 0.38
139 0.4
140 0.35
141 0.36
142 0.37
143 0.37
144 0.41
145 0.39
146 0.32
147 0.33
148 0.34
149 0.39
150 0.39
151 0.4
152 0.45
153 0.55
154 0.6
155 0.67
156 0.73
157 0.71
158 0.77
159 0.75
160 0.75
161 0.73
162 0.75
163 0.71
164 0.67
165 0.61
166 0.51
167 0.49
168 0.45
169 0.4
170 0.33
171 0.31
172 0.27
173 0.27
174 0.27
175 0.22
176 0.17
177 0.14
178 0.14
179 0.11
180 0.1
181 0.09
182 0.06
183 0.06
184 0.07
185 0.07
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.1
193 0.11
194 0.11
195 0.11
196 0.12
197 0.12
198 0.13
199 0.17
200 0.19
201 0.29
202 0.36
203 0.4
204 0.45