Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G4N9

Protein Details
Accession A0A2I1G4N9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-133ARIARRRERNRLAARRSRNRSRNYYNQLHydrophilic
NLS Segment(s)
PositionSequence
94-126RRSRRRSSLDEAARIARRRERNRLAARRSRNRS
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR000837  AP-1  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MSDQFINSEMLWWNLLVEEETSPAVNLFLPQYYLVSSSPLVNEMPGDYLEQSFTPFPGTTSTELDIPNSASPSPPASSNGSTTSTETSNSQSGRRSRRRSSLDEAARIARRRERNRLAARRSRNRSRNYYNQLEQRVVELEDEITRLRSLLGHERNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.09
4 0.09
5 0.08
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.08
12 0.07
13 0.08
14 0.08
15 0.07
16 0.08
17 0.09
18 0.09
19 0.09
20 0.11
21 0.1
22 0.11
23 0.11
24 0.11
25 0.11
26 0.12
27 0.11
28 0.1
29 0.1
30 0.08
31 0.09
32 0.08
33 0.08
34 0.08
35 0.08
36 0.09
37 0.08
38 0.1
39 0.09
40 0.08
41 0.1
42 0.09
43 0.09
44 0.11
45 0.14
46 0.14
47 0.16
48 0.17
49 0.16
50 0.16
51 0.16
52 0.14
53 0.13
54 0.12
55 0.1
56 0.09
57 0.08
58 0.08
59 0.1
60 0.1
61 0.09
62 0.11
63 0.14
64 0.15
65 0.16
66 0.17
67 0.18
68 0.18
69 0.18
70 0.17
71 0.14
72 0.14
73 0.14
74 0.14
75 0.15
76 0.15
77 0.16
78 0.2
79 0.26
80 0.35
81 0.44
82 0.49
83 0.52
84 0.6
85 0.65
86 0.66
87 0.67
88 0.66
89 0.62
90 0.57
91 0.54
92 0.49
93 0.48
94 0.44
95 0.4
96 0.37
97 0.42
98 0.46
99 0.55
100 0.57
101 0.63
102 0.72
103 0.78
104 0.8
105 0.8
106 0.83
107 0.84
108 0.85
109 0.85
110 0.83
111 0.81
112 0.82
113 0.81
114 0.81
115 0.79
116 0.79
117 0.76
118 0.75
119 0.71
120 0.63
121 0.55
122 0.46
123 0.4
124 0.32
125 0.25
126 0.18
127 0.15
128 0.13
129 0.14
130 0.12
131 0.12
132 0.11
133 0.11
134 0.11
135 0.11
136 0.15
137 0.24
138 0.31