Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NZN0

Protein Details
Accession J3NZN0    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-54GMEREIKPARKREKKKNGRKTRPDDGVHBasic
NLS Segment(s)
PositionSequence
32-48IKPARKREKKKNGRKTR
Subcellular Location(s) nucl 23, mito 4
Family & Domain DBs
Amino Acid Sequences MPRRDSPVVQGKDKTRTEENPGLVGTGMEREIKPARKREKKKNGRKTRPDDGVHEKILHIFPTGEGSRRHNGSPNEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.48
4 0.51
5 0.52
6 0.48
7 0.41
8 0.39
9 0.34
10 0.28
11 0.23
12 0.15
13 0.09
14 0.08
15 0.08
16 0.08
17 0.11
18 0.15
19 0.23
20 0.27
21 0.35
22 0.45
23 0.54
24 0.63
25 0.7
26 0.77
27 0.81
28 0.88
29 0.9
30 0.91
31 0.92
32 0.94
33 0.91
34 0.88
35 0.86
36 0.78
37 0.73
38 0.7
39 0.65
40 0.56
41 0.49
42 0.4
43 0.34
44 0.32
45 0.26
46 0.18
47 0.13
48 0.11
49 0.18
50 0.19
51 0.2
52 0.22
53 0.27
54 0.32
55 0.35
56 0.37
57 0.38