Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HH77

Protein Details
Accession A0A2I1HH77    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-31HYSNNCKERRNIVKRKNNICENCHydrophilic
64-93KDCPAEIKIIKRKNNKCKKCGEKGHYTKECHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences CYLCNRKGHYSNNCKERRNIVKRKNNICENCGGKGHFTKECTSDKTEKDQMICYRCNRMGHHAKDCPAEIKIIKRKNNKCKKCGEKGHYTKEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.72
3 0.73
4 0.73
5 0.73
6 0.75
7 0.75
8 0.78
9 0.84
10 0.88
11 0.87
12 0.86
13 0.79
14 0.71
15 0.67
16 0.6
17 0.53
18 0.46
19 0.37
20 0.3
21 0.29
22 0.3
23 0.25
24 0.24
25 0.23
26 0.25
27 0.28
28 0.29
29 0.31
30 0.32
31 0.31
32 0.35
33 0.38
34 0.35
35 0.33
36 0.34
37 0.34
38 0.33
39 0.35
40 0.31
41 0.33
42 0.35
43 0.37
44 0.34
45 0.38
46 0.44
47 0.45
48 0.51
49 0.49
50 0.49
51 0.48
52 0.47
53 0.4
54 0.31
55 0.29
56 0.24
57 0.29
58 0.36
59 0.42
60 0.49
61 0.57
62 0.67
63 0.75
64 0.84
65 0.84
66 0.83
67 0.85
68 0.87
69 0.87
70 0.88
71 0.85
72 0.85
73 0.85