Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GYQ8

Protein Details
Accession A0A2I1GYQ8   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-101AYPNYVYRPNKNKGKNEKRRQARKNAVATFNSHydrophilic
NLS Segment(s)
PositionSequence
80-93KNKGKNEKRRQARK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MQPEKRPPRPPNAFILYRRAKQPAILAAHRNLTNAEISRFISSCWKSETDEERLAWERYADQKKLEHMQAYPNYVYRPNKNKGKNEKRRQARKNAVATFNSQDTTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.62
4 0.56
5 0.56
6 0.51
7 0.44
8 0.39
9 0.41
10 0.38
11 0.37
12 0.37
13 0.37
14 0.35
15 0.39
16 0.37
17 0.33
18 0.26
19 0.21
20 0.2
21 0.17
22 0.16
23 0.13
24 0.14
25 0.15
26 0.15
27 0.14
28 0.19
29 0.19
30 0.19
31 0.2
32 0.2
33 0.2
34 0.25
35 0.29
36 0.27
37 0.29
38 0.27
39 0.27
40 0.29
41 0.28
42 0.22
43 0.18
44 0.14
45 0.2
46 0.25
47 0.24
48 0.23
49 0.24
50 0.28
51 0.32
52 0.32
53 0.26
54 0.22
55 0.28
56 0.29
57 0.31
58 0.29
59 0.26
60 0.25
61 0.29
62 0.33
63 0.34
64 0.39
65 0.44
66 0.53
67 0.6
68 0.68
69 0.74
70 0.81
71 0.84
72 0.86
73 0.88
74 0.9
75 0.93
76 0.92
77 0.91
78 0.91
79 0.89
80 0.88
81 0.85
82 0.81
83 0.72
84 0.68
85 0.61
86 0.53
87 0.44