Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HQD7

Protein Details
Accession A0A2I1HQD7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-80RERERDRDRDRDRQYRHYHQBasic
NLS Segment(s)
PositionSequence
24-69RERERQREGEERANRRAKAEKERERSHGRENRERERERERERDRDR
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MSIIVFQHDTELEIAFFRERAAVRERERQREGEERANRRAKAEKERERSHGRENRERERERERERDRDRDRDRQYRHYHQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.11
6 0.11
7 0.14
8 0.19
9 0.25
10 0.29
11 0.39
12 0.45
13 0.5
14 0.52
15 0.51
16 0.5
17 0.51
18 0.51
19 0.51
20 0.53
21 0.5
22 0.56
23 0.59
24 0.55
25 0.49
26 0.51
27 0.46
28 0.48
29 0.54
30 0.55
31 0.57
32 0.61
33 0.65
34 0.65
35 0.64
36 0.64
37 0.59
38 0.57
39 0.58
40 0.62
41 0.65
42 0.68
43 0.68
44 0.63
45 0.66
46 0.69
47 0.67
48 0.71
49 0.68
50 0.69
51 0.72
52 0.78
53 0.75
54 0.77
55 0.76
56 0.76
57 0.79
58 0.78
59 0.78
60 0.78
61 0.8