Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GYT6

Protein Details
Accession A0A2I1GYT6   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
209-228YTPINIKPSNKKPTRPISPMHydrophilic
NLS Segment(s)
PositionSequence
230-235GEKRRK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027329  TPX2_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005856  C:cytoskeleton  
Pfam View protein in Pfam  
PF06886  TPX2  
Amino Acid Sequences PSPPHVIKANPVPDYKEPYRPVIEHRLIELPMFSLPGEEISKRKSQEIEERIRQEKEKMEKMREFKAQPLPTGSPDCLPTRPYYPPTHPKPFALLTNGEKYQREFYEKVRKEQEYYKENRFHAQPLPNFKREVPRKPECPPPTEPIGFFFFTDTRMEERHIYDEHRRFREKEAEEQRIAKIREEEIRNAEEIRRLRANLVHHAQPIRYYTPINIKPSNKKPTRPISPMIGEKRRKYRDSLSKHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.52
4 0.48
5 0.49
6 0.52
7 0.48
8 0.5
9 0.52
10 0.53
11 0.45
12 0.45
13 0.44
14 0.38
15 0.37
16 0.3
17 0.21
18 0.15
19 0.15
20 0.11
21 0.08
22 0.08
23 0.1
24 0.12
25 0.13
26 0.15
27 0.19
28 0.25
29 0.26
30 0.29
31 0.29
32 0.32
33 0.41
34 0.48
35 0.53
36 0.56
37 0.61
38 0.62
39 0.62
40 0.58
41 0.52
42 0.51
43 0.49
44 0.51
45 0.51
46 0.54
47 0.58
48 0.6
49 0.62
50 0.61
51 0.55
52 0.52
53 0.55
54 0.49
55 0.44
56 0.45
57 0.41
58 0.37
59 0.39
60 0.33
61 0.24
62 0.25
63 0.25
64 0.22
65 0.21
66 0.2
67 0.21
68 0.24
69 0.28
70 0.31
71 0.36
72 0.45
73 0.51
74 0.57
75 0.55
76 0.52
77 0.51
78 0.48
79 0.42
80 0.36
81 0.31
82 0.26
83 0.29
84 0.29
85 0.27
86 0.25
87 0.24
88 0.25
89 0.23
90 0.25
91 0.22
92 0.28
93 0.37
94 0.39
95 0.43
96 0.45
97 0.44
98 0.42
99 0.47
100 0.48
101 0.44
102 0.47
103 0.49
104 0.48
105 0.48
106 0.48
107 0.43
108 0.38
109 0.35
110 0.37
111 0.33
112 0.38
113 0.42
114 0.41
115 0.42
116 0.4
117 0.44
118 0.44
119 0.49
120 0.48
121 0.49
122 0.52
123 0.54
124 0.63
125 0.57
126 0.55
127 0.51
128 0.46
129 0.46
130 0.42
131 0.39
132 0.32
133 0.32
134 0.27
135 0.23
136 0.2
137 0.14
138 0.14
139 0.15
140 0.14
141 0.12
142 0.13
143 0.15
144 0.15
145 0.16
146 0.18
147 0.19
148 0.21
149 0.29
150 0.35
151 0.41
152 0.45
153 0.48
154 0.47
155 0.51
156 0.56
157 0.5
158 0.53
159 0.54
160 0.55
161 0.54
162 0.54
163 0.51
164 0.49
165 0.47
166 0.39
167 0.33
168 0.29
169 0.34
170 0.36
171 0.37
172 0.33
173 0.34
174 0.32
175 0.31
176 0.29
177 0.28
178 0.26
179 0.28
180 0.27
181 0.26
182 0.27
183 0.3
184 0.33
185 0.35
186 0.38
187 0.37
188 0.38
189 0.39
190 0.37
191 0.36
192 0.36
193 0.3
194 0.27
195 0.24
196 0.25
197 0.33
198 0.39
199 0.43
200 0.46
201 0.51
202 0.59
203 0.67
204 0.74
205 0.71
206 0.72
207 0.75
208 0.78
209 0.8
210 0.76
211 0.71
212 0.69
213 0.69
214 0.71
215 0.71
216 0.71
217 0.69
218 0.72
219 0.77
220 0.78
221 0.73
222 0.71
223 0.72
224 0.72