Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HE16

Protein Details
Accession A0A2I1HE16   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
152-207HSPFNRQPQSNKDKKKNLKSLKGKKADPKVSTSSNKKNSRDKPNKHNKVNDDTRSLHydrophilic
NLS Segment(s)
PositionSequence
163-196KDKKKNLKSLKGKKADPKVSTSSNKKNSRDKPNK
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MARSHDEILKQLSSWGKVLEISFKLQHKFQSIWTKMILRPAIDTDFVMRTWWQKLDGQYVRWFPGHWKLKDRKERERFQAKLHIPSDAPDEKFANFQNGKPLDVFMQKTLRGKSCSAYMEKGNKFLTIYFESQKDLHQALEIPCDWKLTISHSPFNRQPQSNKDKKKNLKSLKGKKADPKVSTSSNKKNSRDKPNKHNKVNDDTRSLLKIILNLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.2
4 0.21
5 0.21
6 0.23
7 0.21
8 0.23
9 0.27
10 0.31
11 0.33
12 0.34
13 0.37
14 0.35
15 0.34
16 0.38
17 0.44
18 0.42
19 0.42
20 0.43
21 0.44
22 0.4
23 0.46
24 0.41
25 0.3
26 0.29
27 0.3
28 0.28
29 0.24
30 0.23
31 0.18
32 0.18
33 0.17
34 0.16
35 0.14
36 0.15
37 0.17
38 0.18
39 0.17
40 0.2
41 0.22
42 0.31
43 0.33
44 0.34
45 0.37
46 0.38
47 0.38
48 0.34
49 0.32
50 0.25
51 0.32
52 0.38
53 0.35
54 0.42
55 0.49
56 0.58
57 0.68
58 0.72
59 0.73
60 0.73
61 0.78
62 0.78
63 0.8
64 0.72
65 0.67
66 0.69
67 0.61
68 0.6
69 0.52
70 0.45
71 0.35
72 0.33
73 0.34
74 0.28
75 0.26
76 0.2
77 0.2
78 0.19
79 0.21
80 0.2
81 0.22
82 0.19
83 0.19
84 0.25
85 0.25
86 0.25
87 0.23
88 0.23
89 0.18
90 0.2
91 0.2
92 0.14
93 0.16
94 0.17
95 0.2
96 0.22
97 0.23
98 0.23
99 0.23
100 0.21
101 0.23
102 0.24
103 0.23
104 0.23
105 0.24
106 0.3
107 0.3
108 0.33
109 0.29
110 0.27
111 0.25
112 0.24
113 0.23
114 0.18
115 0.2
116 0.19
117 0.19
118 0.2
119 0.2
120 0.2
121 0.19
122 0.16
123 0.14
124 0.12
125 0.15
126 0.14
127 0.17
128 0.16
129 0.15
130 0.14
131 0.15
132 0.14
133 0.12
134 0.12
135 0.14
136 0.22
137 0.24
138 0.3
139 0.31
140 0.38
141 0.41
142 0.5
143 0.51
144 0.48
145 0.49
146 0.54
147 0.62
148 0.66
149 0.72
150 0.73
151 0.76
152 0.82
153 0.87
154 0.88
155 0.87
156 0.88
157 0.89
158 0.9
159 0.9
160 0.88
161 0.84
162 0.83
163 0.83
164 0.81
165 0.73
166 0.69
167 0.64
168 0.64
169 0.66
170 0.66
171 0.66
172 0.67
173 0.73
174 0.74
175 0.78
176 0.8
177 0.82
178 0.84
179 0.83
180 0.84
181 0.87
182 0.91
183 0.9
184 0.89
185 0.85
186 0.85
187 0.86
188 0.8
189 0.75
190 0.68
191 0.62
192 0.55
193 0.48
194 0.4
195 0.32
196 0.28