Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PF97

Protein Details
Accession J3PF97    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
91-120GGAARADRRRGRRTSRRRRARQASVVKETLHydrophilic
NLS Segment(s)
PositionSequence
95-111RADRRRGRRTSRRRRAR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MYARRGRGGPSKATPASCKAAPQERPYVPRPSRTQQLLNPKLRPELTNDAPDVLQKKTGVADAELAKKAAQREKDLKSRQDSDSGSESDDGGAARADRRRGRRTSRRRRARQASVVKETLSVPALCPELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.46
4 0.4
5 0.38
6 0.36
7 0.41
8 0.44
9 0.46
10 0.49
11 0.49
12 0.53
13 0.54
14 0.59
15 0.53
16 0.55
17 0.57
18 0.54
19 0.57
20 0.56
21 0.58
22 0.54
23 0.62
24 0.64
25 0.64
26 0.61
27 0.55
28 0.53
29 0.49
30 0.43
31 0.38
32 0.37
33 0.33
34 0.33
35 0.31
36 0.28
37 0.27
38 0.28
39 0.23
40 0.16
41 0.15
42 0.11
43 0.11
44 0.11
45 0.12
46 0.11
47 0.09
48 0.12
49 0.12
50 0.15
51 0.15
52 0.14
53 0.13
54 0.14
55 0.16
56 0.18
57 0.18
58 0.21
59 0.28
60 0.33
61 0.42
62 0.46
63 0.49
64 0.51
65 0.53
66 0.49
67 0.48
68 0.43
69 0.37
70 0.36
71 0.31
72 0.26
73 0.22
74 0.21
75 0.14
76 0.14
77 0.1
78 0.07
79 0.07
80 0.06
81 0.09
82 0.12
83 0.19
84 0.25
85 0.33
86 0.4
87 0.48
88 0.59
89 0.66
90 0.75
91 0.8
92 0.85
93 0.88
94 0.91
95 0.94
96 0.93
97 0.93
98 0.92
99 0.91
100 0.89
101 0.85
102 0.77
103 0.66
104 0.57
105 0.48
106 0.4
107 0.32
108 0.23
109 0.16
110 0.17