Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FXE6

Protein Details
Accession A0A2I1FXE6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-67RWWDRINKGKQWKDIKDRYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7golg 7, plas 5, extr 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MTDVRNSALEKYSRGVYRTLFRRNSVFLLGIFASAFAFEMAFDSATDRWWDRINKGKQWKDIKDRYSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.26
4 0.33
5 0.39
6 0.45
7 0.42
8 0.42
9 0.44
10 0.44
11 0.43
12 0.36
13 0.29
14 0.2
15 0.19
16 0.17
17 0.14
18 0.11
19 0.09
20 0.07
21 0.06
22 0.06
23 0.03
24 0.03
25 0.03
26 0.04
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.08
33 0.1
34 0.1
35 0.11
36 0.17
37 0.19
38 0.23
39 0.33
40 0.4
41 0.47
42 0.57
43 0.63
44 0.66
45 0.74
46 0.78
47 0.79
48 0.81