Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HSZ2

Protein Details
Accession A0A2I1HSZ2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-91LDDRVKRDTVGKKAKKRKVDBasic
NLS Segment(s)
PositionSequence
82-90GKKAKKRKV
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044044  DUF5679  
Pfam View protein in Pfam  
PF18930  DUF5679  
Amino Acid Sequences MTRFYCLRCKKETETASEVQDMTTSGRYRLHGDCTVCGIRKNTFTGEGWVIKKKSKKEKEDAACQQCVAKCLDDRVKRDTVGKKAKKRKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.52
4 0.47
5 0.41
6 0.31
7 0.27
8 0.2
9 0.15
10 0.17
11 0.15
12 0.14
13 0.16
14 0.17
15 0.21
16 0.23
17 0.26
18 0.26
19 0.26
20 0.26
21 0.28
22 0.29
23 0.26
24 0.26
25 0.23
26 0.21
27 0.21
28 0.22
29 0.19
30 0.18
31 0.18
32 0.18
33 0.19
34 0.2
35 0.2
36 0.23
37 0.23
38 0.25
39 0.29
40 0.35
41 0.44
42 0.49
43 0.55
44 0.59
45 0.68
46 0.71
47 0.77
48 0.79
49 0.74
50 0.65
51 0.57
52 0.53
53 0.44
54 0.38
55 0.3
56 0.23
57 0.18
58 0.25
59 0.34
60 0.37
61 0.39
62 0.43
63 0.45
64 0.44
65 0.51
66 0.51
67 0.53
68 0.57
69 0.64
70 0.68
71 0.76