Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GAX6

Protein Details
Accession A0A2I1GAX6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-97IEQAKCLKSSKCKKIRAKVSKKVIASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MPHSNINQFFAKTCLSKWNNVSIFAKFIYYESPSTTPKQVLDMYNRNRFDIISTKDTKNNVMQYVRDIIVKIEQAKCLKSSKCKKIRAKVSKKVIASLSYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.35
4 0.36
5 0.44
6 0.42
7 0.45
8 0.45
9 0.36
10 0.35
11 0.29
12 0.27
13 0.17
14 0.16
15 0.14
16 0.15
17 0.14
18 0.15
19 0.18
20 0.2
21 0.22
22 0.24
23 0.22
24 0.2
25 0.22
26 0.22
27 0.22
28 0.27
29 0.33
30 0.38
31 0.44
32 0.45
33 0.42
34 0.39
35 0.36
36 0.31
37 0.29
38 0.26
39 0.24
40 0.28
41 0.29
42 0.32
43 0.33
44 0.33
45 0.31
46 0.29
47 0.27
48 0.25
49 0.24
50 0.23
51 0.26
52 0.24
53 0.2
54 0.17
55 0.14
56 0.15
57 0.17
58 0.19
59 0.17
60 0.21
61 0.23
62 0.24
63 0.26
64 0.3
65 0.32
66 0.39
67 0.47
68 0.54
69 0.61
70 0.7
71 0.78
72 0.82
73 0.89
74 0.9
75 0.9
76 0.89
77 0.9
78 0.88
79 0.79
80 0.74
81 0.67