Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GDU2

Protein Details
Accession A0A2I1GDU2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-85NNVKKIPAPEERKKRAKKGYVIIHydrophilic
NLS Segment(s)
PositionSequence
67-80KIPAPEERKKRAKK
Subcellular Location(s) mito 20, cyto_nucl 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01658  Ribosomal_L30  
Amino Acid Sequences NSSKIPNGFFKITLRRSTIGLPLKLRRVVRALGLRRLQQTVYHSQTAYIAGMILKVKEILQVNNVKKIPAPEERKKRAKKGYVII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.4
4 0.4
5 0.42
6 0.4
7 0.39
8 0.4
9 0.4
10 0.44
11 0.47
12 0.46
13 0.4
14 0.35
15 0.32
16 0.33
17 0.37
18 0.36
19 0.38
20 0.41
21 0.41
22 0.4
23 0.4
24 0.34
25 0.28
26 0.28
27 0.28
28 0.28
29 0.26
30 0.24
31 0.23
32 0.23
33 0.21
34 0.17
35 0.1
36 0.06
37 0.05
38 0.06
39 0.07
40 0.06
41 0.05
42 0.06
43 0.06
44 0.1
45 0.12
46 0.12
47 0.17
48 0.26
49 0.28
50 0.35
51 0.36
52 0.32
53 0.32
54 0.34
55 0.34
56 0.35
57 0.42
58 0.45
59 0.56
60 0.65
61 0.74
62 0.8
63 0.84
64 0.85
65 0.85