Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HKG5

Protein Details
Accession A0A2I1HKG5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-84GDEDDRRKNNKKKIKTKNLEKENKNKLRKKBasic
NLS Segment(s)
PositionSequence
60-84RRKNNKKKIKTKNLEKENKNKLRKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSPGWRFIYNEIKDRIWIPRCEEVKRLEEKANITKTDLKKRKNKPIETSETDETGDEDDRRKNNKKKIKTKNLEKENKNKLRKKISLVTREKITGNLVDGININNCWDTTVKISYLDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.41
4 0.4
5 0.38
6 0.44
7 0.46
8 0.48
9 0.5
10 0.46
11 0.47
12 0.49
13 0.47
14 0.42
15 0.42
16 0.43
17 0.47
18 0.47
19 0.41
20 0.38
21 0.42
22 0.44
23 0.52
24 0.55
25 0.55
26 0.6
27 0.68
28 0.76
29 0.78
30 0.8
31 0.77
32 0.78
33 0.79
34 0.74
35 0.71
36 0.61
37 0.52
38 0.45
39 0.36
40 0.27
41 0.2
42 0.15
43 0.1
44 0.11
45 0.13
46 0.17
47 0.23
48 0.32
49 0.38
50 0.47
51 0.55
52 0.64
53 0.71
54 0.79
55 0.84
56 0.85
57 0.89
58 0.89
59 0.91
60 0.9
61 0.86
62 0.84
63 0.84
64 0.84
65 0.83
66 0.79
67 0.77
68 0.78
69 0.76
70 0.74
71 0.72
72 0.71
73 0.72
74 0.72
75 0.68
76 0.62
77 0.59
78 0.52
79 0.45
80 0.38
81 0.28
82 0.23
83 0.22
84 0.19
85 0.17
86 0.17
87 0.17
88 0.17
89 0.15
90 0.14
91 0.11
92 0.11
93 0.12
94 0.12
95 0.13
96 0.15
97 0.19
98 0.18