Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H7Y9

Protein Details
Accession A0A2I1H7Y9   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
182-213MDVDNNLQKKKKRRNKKRKRTRVQYDKNGTINHydrophilic
NLS Segment(s)
PositionSequence
190-203KKKKRRNKKRKRTR
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
Amino Acid Sequences MLPKLLYMLLLNHLQYFRFSTSEYIEFEKTVMKQDALLKPGKIPIRLHKPESKVIPAVYFTAVFLIKRSGEALRNLLEDTLFSVKLAEQDSERIKIENEIVLANCAAMTNKMNDMEKEKGDRELTSGLMIADLENRIRNLEADITAKERIILEKNETINSLWEKINAQEEKVVTSTCNMTNMDVDNNLQKKKKRRNKKRKRTRVQYDKNGTINELKLGLIRDADKDRLEEHFAEKSRDITFYDIPAYWSDREIFAKLHDNVGFVEYMRSKRCYKYKTVRATLHFSKEYEKIYKEGGVNVSLTRNNRLKKYSYKLSAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.2
5 0.19
6 0.2
7 0.19
8 0.24
9 0.27
10 0.27
11 0.27
12 0.26
13 0.25
14 0.25
15 0.26
16 0.22
17 0.25
18 0.25
19 0.21
20 0.24
21 0.32
22 0.37
23 0.37
24 0.39
25 0.33
26 0.33
27 0.39
28 0.4
29 0.36
30 0.36
31 0.42
32 0.49
33 0.55
34 0.59
35 0.6
36 0.61
37 0.63
38 0.64
39 0.59
40 0.51
41 0.46
42 0.42
43 0.35
44 0.32
45 0.26
46 0.21
47 0.15
48 0.15
49 0.14
50 0.12
51 0.12
52 0.13
53 0.11
54 0.12
55 0.14
56 0.15
57 0.17
58 0.2
59 0.22
60 0.21
61 0.22
62 0.22
63 0.2
64 0.17
65 0.13
66 0.13
67 0.13
68 0.11
69 0.1
70 0.1
71 0.1
72 0.13
73 0.15
74 0.13
75 0.11
76 0.16
77 0.18
78 0.21
79 0.21
80 0.19
81 0.18
82 0.19
83 0.19
84 0.16
85 0.14
86 0.12
87 0.12
88 0.12
89 0.11
90 0.09
91 0.08
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.12
99 0.13
100 0.13
101 0.18
102 0.2
103 0.21
104 0.23
105 0.22
106 0.24
107 0.24
108 0.23
109 0.21
110 0.19
111 0.17
112 0.14
113 0.13
114 0.09
115 0.08
116 0.08
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.08
126 0.08
127 0.08
128 0.09
129 0.1
130 0.1
131 0.12
132 0.12
133 0.12
134 0.11
135 0.1
136 0.11
137 0.12
138 0.13
139 0.14
140 0.18
141 0.19
142 0.19
143 0.2
144 0.18
145 0.17
146 0.17
147 0.16
148 0.12
149 0.12
150 0.12
151 0.12
152 0.19
153 0.17
154 0.16
155 0.16
156 0.16
157 0.16
158 0.17
159 0.16
160 0.09
161 0.1
162 0.12
163 0.1
164 0.12
165 0.11
166 0.11
167 0.12
168 0.12
169 0.12
170 0.1
171 0.11
172 0.14
173 0.17
174 0.21
175 0.24
176 0.28
177 0.38
178 0.48
179 0.58
180 0.64
181 0.72
182 0.8
183 0.88
184 0.94
185 0.95
186 0.96
187 0.97
188 0.96
189 0.96
190 0.96
191 0.95
192 0.94
193 0.91
194 0.85
195 0.77
196 0.67
197 0.57
198 0.49
199 0.39
200 0.29
201 0.21
202 0.15
203 0.13
204 0.14
205 0.12
206 0.11
207 0.11
208 0.14
209 0.16
210 0.18
211 0.18
212 0.17
213 0.18
214 0.2
215 0.22
216 0.2
217 0.2
218 0.24
219 0.25
220 0.28
221 0.27
222 0.27
223 0.25
224 0.25
225 0.23
226 0.21
227 0.21
228 0.19
229 0.21
230 0.18
231 0.18
232 0.19
233 0.21
234 0.17
235 0.17
236 0.17
237 0.17
238 0.18
239 0.19
240 0.18
241 0.18
242 0.25
243 0.24
244 0.29
245 0.27
246 0.25
247 0.24
248 0.25
249 0.22
250 0.14
251 0.18
252 0.17
253 0.2
254 0.23
255 0.27
256 0.29
257 0.37
258 0.46
259 0.47
260 0.54
261 0.61
262 0.68
263 0.74
264 0.8
265 0.8
266 0.76
267 0.79
268 0.76
269 0.73
270 0.66
271 0.56
272 0.51
273 0.48
274 0.48
275 0.45
276 0.4
277 0.34
278 0.34
279 0.38
280 0.35
281 0.35
282 0.32
283 0.28
284 0.27
285 0.27
286 0.28
287 0.27
288 0.28
289 0.32
290 0.37
291 0.41
292 0.46
293 0.5
294 0.53
295 0.58
296 0.65
297 0.67