Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GLN3

Protein Details
Accession A0A2I1GLN3   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
65-93GYVYRPKRPIFNDKRKRSKTTPSKQPISTHydrophilic
NLS Segment(s)
PositionSequence
70-83PKRPIFNDKRKRSK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences KIPRPPNAFILYRRAKQKLITKERSNAKISQLLAKMWRDETEEEKLRWRKIADRKKVEHMQAHPGYVYRPKRPIFNDKRKRSKTTPSKQPIST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.52
4 0.58
5 0.59
6 0.62
7 0.66
8 0.64
9 0.69
10 0.75
11 0.73
12 0.68
13 0.59
14 0.52
15 0.48
16 0.43
17 0.41
18 0.34
19 0.3
20 0.3
21 0.29
22 0.26
23 0.22
24 0.22
25 0.18
26 0.18
27 0.2
28 0.23
29 0.25
30 0.25
31 0.32
32 0.34
33 0.33
34 0.33
35 0.31
36 0.32
37 0.39
38 0.49
39 0.51
40 0.57
41 0.6
42 0.66
43 0.71
44 0.68
45 0.63
46 0.56
47 0.56
48 0.48
49 0.45
50 0.37
51 0.31
52 0.28
53 0.3
54 0.33
55 0.29
56 0.35
57 0.36
58 0.43
59 0.49
60 0.58
61 0.61
62 0.67
63 0.72
64 0.75
65 0.85
66 0.85
67 0.88
68 0.83
69 0.84
70 0.83
71 0.83
72 0.84
73 0.82