Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FZ02

Protein Details
Accession A0A2I1FZ02    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-94ESIGLPPKKEKKPPRTKPPKGAKHERNAPERBasic
NLS Segment(s)
PositionSequence
69-124PPKKEKKPPRTKPPKGAKHERNAPERKAKIQKALEEMPKTIENWRKGKLEEKEKSK
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSAIKRISEQALNHLKRTYTPSDFKPKFMYKNIWGRKRYMHPKVSLRKLADMRKNAECLGINTESIGLPPKKEKKPPRTKPPKGAKHERNAPERKAKIQKALEEMPKTIENWRKGKLEEKEKSKPSLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.37
4 0.42
5 0.4
6 0.36
7 0.39
8 0.44
9 0.53
10 0.54
11 0.54
12 0.56
13 0.55
14 0.54
15 0.54
16 0.54
17 0.51
18 0.6
19 0.67
20 0.68
21 0.63
22 0.61
23 0.62
24 0.65
25 0.67
26 0.66
27 0.63
28 0.61
29 0.69
30 0.75
31 0.75
32 0.71
33 0.63
34 0.61
35 0.6
36 0.61
37 0.58
38 0.54
39 0.5
40 0.46
41 0.46
42 0.39
43 0.35
44 0.27
45 0.22
46 0.21
47 0.17
48 0.14
49 0.12
50 0.13
51 0.1
52 0.1
53 0.13
54 0.09
55 0.09
56 0.16
57 0.24
58 0.29
59 0.38
60 0.48
61 0.55
62 0.67
63 0.76
64 0.81
65 0.85
66 0.88
67 0.89
68 0.9
69 0.89
70 0.87
71 0.88
72 0.85
73 0.83
74 0.84
75 0.81
76 0.8
77 0.76
78 0.73
79 0.72
80 0.67
81 0.66
82 0.66
83 0.62
84 0.62
85 0.61
86 0.59
87 0.56
88 0.6
89 0.59
90 0.52
91 0.48
92 0.43
93 0.39
94 0.35
95 0.36
96 0.37
97 0.37
98 0.4
99 0.44
100 0.45
101 0.46
102 0.54
103 0.56
104 0.59
105 0.61
106 0.65
107 0.69
108 0.71
109 0.74