Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HWM3

Protein Details
Accession A0A2I1HWM3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-81PVNQTVIPKNSRKKDKQKARHydrophilic
NLS Segment(s)
PositionSequence
71-81NSRKKDKQKAR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSWDSFATRAYQVYGDMGDDTESEGPSGDDELFTPTSSSYSKTTPNPVLDTPPILPDVEMTPVNQTVIPKNSRKKDKQKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.1
4 0.1
5 0.08
6 0.08
7 0.09
8 0.09
9 0.08
10 0.07
11 0.07
12 0.07
13 0.07
14 0.08
15 0.06
16 0.05
17 0.06
18 0.09
19 0.09
20 0.09
21 0.09
22 0.08
23 0.09
24 0.1
25 0.12
26 0.1
27 0.12
28 0.16
29 0.17
30 0.22
31 0.25
32 0.27
33 0.27
34 0.26
35 0.28
36 0.25
37 0.26
38 0.21
39 0.18
40 0.17
41 0.14
42 0.13
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.12
49 0.12
50 0.13
51 0.14
52 0.14
53 0.17
54 0.23
55 0.29
56 0.35
57 0.45
58 0.54
59 0.63
60 0.72
61 0.78