Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HL60

Protein Details
Accession A0A2I1HL60   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-25VDKYLEKKSPSRRRKTFIFRDDYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11.833, cyto 7.5, cyto_mito 7.166, mito 5.5
Family & Domain DBs
Amino Acid Sequences LVDKYLEKKSPSRRRKTFIFRDDYDLIISVLREPSNTKIGSVKDRSWIKNTFHIRELGTESNPNTQVVTIAKDINDTEIIRTVCPFDRIYDILCKVHAGVLKHVGATKMWDVVGDIVIILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.86
4 0.86
5 0.84
6 0.82
7 0.74
8 0.72
9 0.67
10 0.57
11 0.47
12 0.37
13 0.27
14 0.19
15 0.17
16 0.11
17 0.11
18 0.1
19 0.1
20 0.11
21 0.14
22 0.19
23 0.19
24 0.19
25 0.2
26 0.23
27 0.3
28 0.32
29 0.31
30 0.33
31 0.39
32 0.4
33 0.41
34 0.44
35 0.39
36 0.44
37 0.48
38 0.43
39 0.39
40 0.38
41 0.34
42 0.3
43 0.31
44 0.24
45 0.2
46 0.19
47 0.18
48 0.19
49 0.19
50 0.17
51 0.13
52 0.11
53 0.12
54 0.1
55 0.12
56 0.1
57 0.1
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.1
64 0.1
65 0.14
66 0.14
67 0.13
68 0.14
69 0.15
70 0.14
71 0.17
72 0.17
73 0.14
74 0.17
75 0.18
76 0.2
77 0.23
78 0.25
79 0.23
80 0.22
81 0.21
82 0.18
83 0.2
84 0.2
85 0.17
86 0.18
87 0.23
88 0.23
89 0.23
90 0.25
91 0.22
92 0.2
93 0.22
94 0.19
95 0.16
96 0.15
97 0.14
98 0.14
99 0.14
100 0.15
101 0.11