Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GTP3

Protein Details
Accession A0A2I1GTP3    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-42SWKVKSWKLKRFSRSKNQFCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.999, nucl 11.5, mito 10, cyto_nucl 9.166, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLCYKIEGSYGPNKDPYYLLISWKVKSWKLKRFSRSKNQFCLVLHESKESPLPIVSNKMNNFFESKHKNYKNSNDRDGFHLKNKKFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.3
4 0.27
5 0.24
6 0.25
7 0.28
8 0.3
9 0.29
10 0.34
11 0.35
12 0.33
13 0.42
14 0.48
15 0.48
16 0.55
17 0.63
18 0.67
19 0.73
20 0.78
21 0.8
22 0.82
23 0.8
24 0.78
25 0.72
26 0.66
27 0.56
28 0.54
29 0.46
30 0.39
31 0.32
32 0.27
33 0.25
34 0.22
35 0.23
36 0.16
37 0.13
38 0.1
39 0.1
40 0.1
41 0.14
42 0.16
43 0.2
44 0.22
45 0.27
46 0.27
47 0.27
48 0.29
49 0.26
50 0.33
51 0.35
52 0.4
53 0.45
54 0.5
55 0.55
56 0.61
57 0.7
58 0.72
59 0.72
60 0.75
61 0.7
62 0.66
63 0.66
64 0.66
65 0.59
66 0.59
67 0.61