Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GMS0

Protein Details
Accession A0A2I1GMS0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
15-40FDRWYDGKLSKKERKDRDKWQLIRDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MLKDGYFSTSLNKHFDRWYDGKLSKKERKDRDKWQLIRDISEDEIVECKRRHYKIKLNGGDDRNGLKKGIIWSLKPIRSQGDNIRAEKVKKLLISVDTSQARKEDNKKAVTPTIMMRRKVLEDFVSPKVEELKNIFKECREEMEWEVLSMKAYKEFQDVRMVLRDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.4
4 0.39
5 0.4
6 0.42
7 0.46
8 0.51
9 0.56
10 0.63
11 0.63
12 0.69
13 0.74
14 0.76
15 0.82
16 0.83
17 0.85
18 0.86
19 0.88
20 0.84
21 0.81
22 0.8
23 0.7
24 0.64
25 0.55
26 0.46
27 0.36
28 0.31
29 0.24
30 0.16
31 0.18
32 0.16
33 0.19
34 0.17
35 0.21
36 0.27
37 0.31
38 0.39
39 0.44
40 0.53
41 0.58
42 0.69
43 0.7
44 0.67
45 0.71
46 0.65
47 0.59
48 0.5
49 0.43
50 0.35
51 0.29
52 0.24
53 0.17
54 0.17
55 0.16
56 0.21
57 0.2
58 0.18
59 0.25
60 0.32
61 0.34
62 0.32
63 0.32
64 0.28
65 0.28
66 0.31
67 0.29
68 0.32
69 0.33
70 0.33
71 0.35
72 0.35
73 0.34
74 0.33
75 0.29
76 0.22
77 0.18
78 0.18
79 0.16
80 0.16
81 0.19
82 0.18
83 0.23
84 0.23
85 0.23
86 0.23
87 0.22
88 0.22
89 0.23
90 0.29
91 0.32
92 0.36
93 0.4
94 0.41
95 0.44
96 0.45
97 0.41
98 0.36
99 0.33
100 0.36
101 0.38
102 0.37
103 0.35
104 0.34
105 0.36
106 0.35
107 0.32
108 0.24
109 0.22
110 0.26
111 0.28
112 0.29
113 0.26
114 0.25
115 0.29
116 0.27
117 0.25
118 0.25
119 0.31
120 0.34
121 0.38
122 0.39
123 0.35
124 0.39
125 0.38
126 0.4
127 0.33
128 0.3
129 0.3
130 0.36
131 0.34
132 0.3
133 0.29
134 0.22
135 0.21
136 0.19
137 0.17
138 0.15
139 0.16
140 0.17
141 0.24
142 0.26
143 0.27
144 0.35
145 0.35
146 0.34