Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HSW3

Protein Details
Accession A0A2I1HSW3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-108EESYLSSKKKRNKEFEKIRKEGEKBasic
NLS Segment(s)
PositionSequence
92-104KKKRNKEFEKIRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSDIYDELEEIKRRHEIEKHNKSREEYQVDPSCLKCYSTNEIEIGDWFKRFWKIFQKVILEAMSYNRNTYAKLMEYIILTRKDGEESYLSSKKKRNKEFEKIRKEGEKLLDIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.44
4 0.5
5 0.61
6 0.68
7 0.72
8 0.74
9 0.73
10 0.73
11 0.71
12 0.66
13 0.58
14 0.57
15 0.56
16 0.54
17 0.51
18 0.44
19 0.38
20 0.31
21 0.3
22 0.23
23 0.21
24 0.25
25 0.25
26 0.26
27 0.24
28 0.24
29 0.23
30 0.21
31 0.19
32 0.14
33 0.12
34 0.1
35 0.11
36 0.15
37 0.15
38 0.18
39 0.26
40 0.3
41 0.34
42 0.39
43 0.39
44 0.36
45 0.37
46 0.33
47 0.23
48 0.18
49 0.17
50 0.15
51 0.13
52 0.12
53 0.12
54 0.13
55 0.13
56 0.14
57 0.14
58 0.12
59 0.13
60 0.14
61 0.13
62 0.13
63 0.15
64 0.18
65 0.16
66 0.15
67 0.15
68 0.15
69 0.16
70 0.15
71 0.16
72 0.13
73 0.15
74 0.23
75 0.29
76 0.3
77 0.33
78 0.4
79 0.47
80 0.55
81 0.62
82 0.65
83 0.69
84 0.79
85 0.85
86 0.89
87 0.91
88 0.86
89 0.83
90 0.8
91 0.73
92 0.68
93 0.63