Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G5V6

Protein Details
Accession A0A2I1G5V6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
96-118LTAKIQQKEPKSSKKKLFFSPLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSLICRYVAGISDNAFLSSVRGLKSFKIIQTAQGEHKLIGYFEKWVDMRNALDNQFVWDQQNLSWNRYEPPMQQTRSRGNNANKNQRTSGSKLTALTAKIQQKEPKSSKKKLFFSPLSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.12
5 0.12
6 0.13
7 0.12
8 0.14
9 0.15
10 0.15
11 0.22
12 0.24
13 0.23
14 0.27
15 0.27
16 0.3
17 0.35
18 0.37
19 0.34
20 0.35
21 0.34
22 0.28
23 0.29
24 0.24
25 0.18
26 0.16
27 0.13
28 0.1
29 0.1
30 0.13
31 0.11
32 0.12
33 0.13
34 0.13
35 0.14
36 0.16
37 0.18
38 0.15
39 0.16
40 0.15
41 0.16
42 0.15
43 0.15
44 0.12
45 0.1
46 0.1
47 0.1
48 0.17
49 0.16
50 0.16
51 0.17
52 0.17
53 0.18
54 0.19
55 0.21
56 0.16
57 0.22
58 0.28
59 0.3
60 0.33
61 0.37
62 0.43
63 0.47
64 0.48
65 0.5
66 0.5
67 0.58
68 0.62
69 0.69
70 0.66
71 0.64
72 0.62
73 0.58
74 0.55
75 0.5
76 0.49
77 0.42
78 0.4
79 0.37
80 0.37
81 0.36
82 0.32
83 0.3
84 0.3
85 0.32
86 0.33
87 0.39
88 0.43
89 0.46
90 0.55
91 0.6
92 0.64
93 0.67
94 0.74
95 0.78
96 0.81
97 0.82
98 0.81
99 0.82