Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NX25

Protein Details
Accession J3NX25    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MWYGRETRPKVKKSLRYFKRELDKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MWYGRETRPKVKKSLRYFKRELDKAKNESDGELSMHREKIMELERGPPYCYEQEVAACGSLTITKQRQLQPVINRISQVTATRQAYLWSLRVSNASLELLKEGMGNSHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.81
5 0.8
6 0.8
7 0.77
8 0.75
9 0.74
10 0.73
11 0.69
12 0.67
13 0.63
14 0.53
15 0.47
16 0.4
17 0.31
18 0.24
19 0.21
20 0.21
21 0.18
22 0.18
23 0.17
24 0.15
25 0.14
26 0.17
27 0.2
28 0.19
29 0.17
30 0.22
31 0.25
32 0.25
33 0.26
34 0.22
35 0.21
36 0.19
37 0.19
38 0.14
39 0.12
40 0.11
41 0.11
42 0.11
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.09
50 0.1
51 0.14
52 0.2
53 0.24
54 0.29
55 0.33
56 0.39
57 0.41
58 0.48
59 0.48
60 0.44
61 0.4
62 0.36
63 0.33
64 0.28
65 0.23
66 0.19
67 0.22
68 0.23
69 0.23
70 0.23
71 0.22
72 0.23
73 0.24
74 0.22
75 0.17
76 0.17
77 0.17
78 0.18
79 0.18
80 0.17
81 0.16
82 0.15
83 0.14
84 0.14
85 0.14
86 0.13
87 0.12
88 0.11
89 0.1