Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HTV6

Protein Details
Accession A0A2I1HTV6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-93HEKLVKRLTKNPPQNKNKAKEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR022155  DUF3684  
Pfam View protein in Pfam  
PF12449  DUF3684  
Amino Acid Sequences LALKYFIDNFDIYSQFYKPEEVNIAFLPCSDTYAKPSECYVDDKCTIMNFQIIREDLRSEAENFGVRQHPNHEKLVKRLTKNPPQNKNKAKEIFKYLSSQQEDFTDSDWDTLNNFEFIPIQDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.19
5 0.16
6 0.18
7 0.22
8 0.21
9 0.23
10 0.22
11 0.23
12 0.2
13 0.19
14 0.19
15 0.13
16 0.15
17 0.15
18 0.14
19 0.17
20 0.23
21 0.24
22 0.22
23 0.22
24 0.22
25 0.21
26 0.26
27 0.24
28 0.23
29 0.23
30 0.23
31 0.22
32 0.2
33 0.19
34 0.15
35 0.16
36 0.11
37 0.11
38 0.13
39 0.13
40 0.14
41 0.14
42 0.14
43 0.11
44 0.12
45 0.13
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.12
52 0.14
53 0.13
54 0.13
55 0.18
56 0.24
57 0.26
58 0.31
59 0.34
60 0.33
61 0.39
62 0.48
63 0.48
64 0.45
65 0.51
66 0.55
67 0.6
68 0.68
69 0.72
70 0.73
71 0.76
72 0.83
73 0.83
74 0.8
75 0.8
76 0.78
77 0.74
78 0.68
79 0.68
80 0.62
81 0.54
82 0.52
83 0.46
84 0.47
85 0.45
86 0.4
87 0.33
88 0.31
89 0.32
90 0.28
91 0.26
92 0.2
93 0.16
94 0.17
95 0.16
96 0.14
97 0.12
98 0.14
99 0.14
100 0.12
101 0.11
102 0.11
103 0.12
104 0.13