Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GX97

Protein Details
Accession A0A2I1GX97    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-21PEEWTRKRYLKLRKLNIDSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPEEWTRKRYLKLRKLNIDSPIYIPNEINTLNELSKALKTHSTFEIYKNCCKNRLDQMSFQGDEDDATKFLVNFRSLCFKSENY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.79
4 0.77
5 0.7
6 0.61
7 0.53
8 0.47
9 0.38
10 0.32
11 0.27
12 0.2
13 0.18
14 0.17
15 0.15
16 0.11
17 0.11
18 0.1
19 0.11
20 0.11
21 0.1
22 0.11
23 0.11
24 0.11
25 0.14
26 0.15
27 0.17
28 0.19
29 0.22
30 0.21
31 0.24
32 0.32
33 0.3
34 0.36
35 0.4
36 0.4
37 0.41
38 0.41
39 0.44
40 0.45
41 0.52
42 0.5
43 0.47
44 0.51
45 0.52
46 0.51
47 0.45
48 0.36
49 0.26
50 0.22
51 0.19
52 0.14
53 0.09
54 0.09
55 0.09
56 0.09
57 0.11
58 0.15
59 0.17
60 0.16
61 0.19
62 0.28
63 0.29
64 0.31