Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HQ98

Protein Details
Accession A0A2I1HQ98    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-117SESPSKKKSGTSNKRKGKKKKKBasic
NLS Segment(s)
PositionSequence
100-117SKKKSGTSNKRKGKKKKK
Subcellular Location(s) nucl 25, mito_nucl 13.833, cyto_nucl 13.333
Family & Domain DBs
Amino Acid Sequences KIFEEYTTLNDDFRQRLKDKNRYQDEKNIGEKRPMLESPSKLTWSPDWDLEEIREDPEKHEAWKEMMINRQEQGKILSFSPSTEMEKEEEEIEMHSESPSKKKSGTSNKRKGKKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.39
4 0.49
5 0.56
6 0.62
7 0.69
8 0.75
9 0.74
10 0.77
11 0.77
12 0.74
13 0.71
14 0.71
15 0.66
16 0.57
17 0.55
18 0.52
19 0.44
20 0.41
21 0.35
22 0.3
23 0.3
24 0.3
25 0.32
26 0.32
27 0.32
28 0.28
29 0.3
30 0.27
31 0.26
32 0.25
33 0.22
34 0.21
35 0.2
36 0.2
37 0.18
38 0.19
39 0.15
40 0.15
41 0.15
42 0.13
43 0.14
44 0.18
45 0.17
46 0.16
47 0.17
48 0.17
49 0.15
50 0.18
51 0.19
52 0.17
53 0.22
54 0.23
55 0.22
56 0.22
57 0.24
58 0.22
59 0.2
60 0.21
61 0.18
62 0.18
63 0.17
64 0.19
65 0.15
66 0.16
67 0.18
68 0.17
69 0.17
70 0.16
71 0.17
72 0.16
73 0.17
74 0.18
75 0.15
76 0.14
77 0.11
78 0.11
79 0.12
80 0.11
81 0.1
82 0.09
83 0.12
84 0.14
85 0.21
86 0.24
87 0.25
88 0.26
89 0.32
90 0.42
91 0.5
92 0.6
93 0.64
94 0.71
95 0.79
96 0.86
97 0.91