Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HVJ0

Protein Details
Accession A0A2I1HVJ0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
17-36LTEYYRSKTKQKDNKQIFDRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.333, cyto 7.5, cyto_pero 4.666
Family & Domain DBs
Amino Acid Sequences MDFYRVNEIKNWTCVNLTEYYRSKTKQKDNKQIFDRIKKDLQEVVDSTSLDIVKKEELEKSSTAGRYNMLNGLNGYELLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.28
4 0.26
5 0.28
6 0.3
7 0.32
8 0.35
9 0.37
10 0.41
11 0.44
12 0.53
13 0.56
14 0.63
15 0.7
16 0.75
17 0.81
18 0.79
19 0.79
20 0.76
21 0.75
22 0.67
23 0.61
24 0.56
25 0.48
26 0.45
27 0.38
28 0.32
29 0.25
30 0.23
31 0.2
32 0.18
33 0.17
34 0.15
35 0.14
36 0.13
37 0.11
38 0.1
39 0.09
40 0.08
41 0.1
42 0.11
43 0.13
44 0.14
45 0.18
46 0.18
47 0.19
48 0.24
49 0.24
50 0.25
51 0.22
52 0.22
53 0.2
54 0.22
55 0.24
56 0.19
57 0.19
58 0.17
59 0.18
60 0.18
61 0.16