Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AR43

Protein Details
Accession G3AR43    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
55-74WCFGAKWRKQHPNVTRWWKTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 12, nucl 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010987  Glutathione-S-Trfase_C-like  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004046  GST_C  
KEGG spaa:SPAPADRAFT_62309  -  
Pfam View protein in Pfam  
PF00043  GST_C  
PROSITE View protein in PROSITE  
PS50405  GST_CTER  
Amino Acid Sequences MIPYRKKDVEEARVYLERVVAVFEARLANYTYLVSERITFGDIFSATFFKRGFDWCFGAKWRKQHPNVTRWWKTIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.42
3 0.33
4 0.23
5 0.17
6 0.16
7 0.1
8 0.08
9 0.07
10 0.08
11 0.08
12 0.07
13 0.08
14 0.09
15 0.08
16 0.09
17 0.09
18 0.08
19 0.08
20 0.09
21 0.08
22 0.07
23 0.08
24 0.08
25 0.09
26 0.08
27 0.07
28 0.08
29 0.08
30 0.07
31 0.07
32 0.09
33 0.07
34 0.1
35 0.1
36 0.09
37 0.11
38 0.14
39 0.17
40 0.19
41 0.23
42 0.22
43 0.25
44 0.3
45 0.36
46 0.36
47 0.42
48 0.48
49 0.55
50 0.6
51 0.69
52 0.72
53 0.73
54 0.8
55 0.82
56 0.79