Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HX29

Protein Details
Accession A0A2I1HX29    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20RRDKVRKALCWLKRNNRYYAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046700  DUF6570  
Pfam View protein in Pfam  
PF20209  DUF6570  
Amino Acid Sequences RRDKVRKALCWLKRNNRYYANIIIDDNVLRTLLNKGSIDDLLPQVRDAENRLHHVDYEPRVTDRLDGETDDTIIRNFIPAPFPLCSENHVIDDAFTRIQSETGPVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.72
5 0.67
6 0.64
7 0.57
8 0.49
9 0.44
10 0.37
11 0.31
12 0.25
13 0.21
14 0.14
15 0.09
16 0.07
17 0.08
18 0.09
19 0.09
20 0.12
21 0.12
22 0.12
23 0.14
24 0.14
25 0.14
26 0.13
27 0.14
28 0.12
29 0.12
30 0.11
31 0.11
32 0.11
33 0.11
34 0.11
35 0.14
36 0.15
37 0.18
38 0.2
39 0.19
40 0.19
41 0.2
42 0.22
43 0.19
44 0.21
45 0.18
46 0.17
47 0.17
48 0.17
49 0.18
50 0.15
51 0.15
52 0.13
53 0.12
54 0.13
55 0.13
56 0.13
57 0.12
58 0.11
59 0.08
60 0.08
61 0.07
62 0.06
63 0.07
64 0.07
65 0.09
66 0.1
67 0.13
68 0.14
69 0.16
70 0.18
71 0.18
72 0.19
73 0.22
74 0.23
75 0.21
76 0.21
77 0.19
78 0.17
79 0.19
80 0.18
81 0.14
82 0.13
83 0.13
84 0.12
85 0.13
86 0.12