Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HSU8

Protein Details
Accession A0A2I1HSU8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-52IKELKDQYKNKERRNSVKRKNNTCENCHydrophilic
NLS Segment(s)
PositionSequence
85-86KS
Subcellular Location(s) nucl 15, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MEKSIKNLDKYLGNIVIEVIKIEKEIKELKDQYKNKERRNSVKRKNNTCENCGGKGHFTKDIQIVKWKLKLLKGKIINVKIVVKKSKRPLHQRMSSKENDNNEININNENGNSDQKNTKGKKLYIGDDYITVRNKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.23
4 0.19
5 0.17
6 0.11
7 0.08
8 0.09
9 0.1
10 0.1
11 0.13
12 0.18
13 0.2
14 0.29
15 0.35
16 0.41
17 0.5
18 0.54
19 0.59
20 0.65
21 0.71
22 0.71
23 0.75
24 0.75
25 0.76
26 0.82
27 0.84
28 0.84
29 0.85
30 0.86
31 0.86
32 0.86
33 0.86
34 0.8
35 0.73
36 0.7
37 0.64
38 0.57
39 0.48
40 0.42
41 0.35
42 0.32
43 0.31
44 0.27
45 0.23
46 0.22
47 0.26
48 0.28
49 0.26
50 0.29
51 0.3
52 0.28
53 0.31
54 0.31
55 0.28
56 0.3
57 0.36
58 0.33
59 0.38
60 0.39
61 0.42
62 0.46
63 0.46
64 0.42
65 0.37
66 0.39
67 0.34
68 0.35
69 0.37
70 0.34
71 0.39
72 0.47
73 0.52
74 0.56
75 0.63
76 0.68
77 0.71
78 0.77
79 0.79
80 0.75
81 0.75
82 0.71
83 0.67
84 0.62
85 0.56
86 0.52
87 0.45
88 0.4
89 0.35
90 0.31
91 0.26
92 0.23
93 0.2
94 0.15
95 0.14
96 0.14
97 0.14
98 0.18
99 0.18
100 0.19
101 0.22
102 0.26
103 0.36
104 0.38
105 0.45
106 0.48
107 0.49
108 0.55
109 0.57
110 0.58
111 0.54
112 0.54
113 0.47
114 0.42
115 0.43
116 0.39
117 0.36