Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GLU8

Protein Details
Accession A0A2I1GLU8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-52IYLERKKKFTIKKGRKKCKYKFIKKRHTSFLKKIBasic
NLS Segment(s)
PositionSequence
23-45RKKKFTIKKGRKKCKYKFIKKRH
Subcellular Location(s) mito 15, nucl 8, cyto_mito 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLKMNKFKNDLFNLSIKLIYLERKKKFTIKKGRKKCKYKFIKKRHTSFLKKIIICYTPYKSLILNFIIFIFYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.26
4 0.22
5 0.19
6 0.22
7 0.27
8 0.34
9 0.37
10 0.41
11 0.44
12 0.5
13 0.57
14 0.61
15 0.64
16 0.66
17 0.73
18 0.8
19 0.88
20 0.9
21 0.92
22 0.9
23 0.89
24 0.89
25 0.89
26 0.89
27 0.89
28 0.9
29 0.89
30 0.87
31 0.87
32 0.86
33 0.83
34 0.79
35 0.78
36 0.76
37 0.67
38 0.63
39 0.57
40 0.49
41 0.44
42 0.41
43 0.36
44 0.32
45 0.33
46 0.32
47 0.29
48 0.28
49 0.29
50 0.27
51 0.23
52 0.19
53 0.18