Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GA17

Protein Details
Accession A0A2I1GA17    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-98KSSTKASKTTTGTKKKKRKETRENKQQIQHydrophilic
NLS Segment(s)
PositionSequence
80-91TGTKKKKRKETR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MTPNQQYTYITLNDGFEQRLKDENRYQDKKEIGDKRPIFDSPKKSETSGSESETKKEEVEPYILEQEKGKSSTKASKTTTGTKKKKRKETRENKQQIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.18
4 0.18
5 0.18
6 0.24
7 0.25
8 0.29
9 0.34
10 0.42
11 0.5
12 0.54
13 0.56
14 0.55
15 0.56
16 0.53
17 0.56
18 0.55
19 0.48
20 0.53
21 0.51
22 0.47
23 0.47
24 0.45
25 0.42
26 0.4
27 0.44
28 0.4
29 0.43
30 0.42
31 0.4
32 0.4
33 0.37
34 0.36
35 0.31
36 0.27
37 0.3
38 0.29
39 0.29
40 0.29
41 0.27
42 0.21
43 0.19
44 0.18
45 0.14
46 0.15
47 0.14
48 0.14
49 0.19
50 0.19
51 0.18
52 0.18
53 0.18
54 0.19
55 0.21
56 0.21
57 0.18
58 0.21
59 0.3
60 0.35
61 0.4
62 0.41
63 0.46
64 0.49
65 0.57
66 0.64
67 0.65
68 0.71
69 0.74
70 0.81
71 0.83
72 0.9
73 0.91
74 0.92
75 0.92
76 0.93
77 0.94
78 0.95