Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GNX5

Protein Details
Accession A0A2I1GNX5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-122LEMKNRQKNTVKKKVNNNNHKENHYEKSKRWKENNLKRERIAHydrophilic
NLS Segment(s)
PositionSequence
106-126EKSKRWKENNLKRERIASERK
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004087  KH_dom  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00013  KH_1  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
Amino Acid Sequences MQSPTKIKIPKIISFGRLIGPGGCNLKPIEEETGTHIYVITDAKPPHIEVKINEKITLLSCKDRIKEASDKLKELMKTIDLEMKNRQKNTVKKKVNNNNHKENHYEKSKRWKENNLKRERIASERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.38
4 0.33
5 0.28
6 0.22
7 0.19
8 0.19
9 0.2
10 0.18
11 0.18
12 0.17
13 0.17
14 0.17
15 0.18
16 0.19
17 0.16
18 0.16
19 0.2
20 0.23
21 0.22
22 0.21
23 0.19
24 0.14
25 0.15
26 0.15
27 0.11
28 0.12
29 0.12
30 0.14
31 0.15
32 0.16
33 0.18
34 0.19
35 0.2
36 0.17
37 0.26
38 0.32
39 0.31
40 0.31
41 0.27
42 0.26
43 0.26
44 0.28
45 0.2
46 0.16
47 0.19
48 0.21
49 0.22
50 0.23
51 0.23
52 0.23
53 0.28
54 0.31
55 0.37
56 0.37
57 0.37
58 0.36
59 0.38
60 0.34
61 0.29
62 0.25
63 0.16
64 0.16
65 0.16
66 0.21
67 0.18
68 0.21
69 0.28
70 0.35
71 0.39
72 0.38
73 0.44
74 0.45
75 0.55
76 0.63
77 0.65
78 0.66
79 0.69
80 0.79
81 0.84
82 0.86
83 0.88
84 0.85
85 0.85
86 0.81
87 0.77
88 0.72
89 0.66
90 0.63
91 0.62
92 0.6
93 0.56
94 0.61
95 0.68
96 0.72
97 0.74
98 0.77
99 0.78
100 0.84
101 0.88
102 0.87
103 0.85
104 0.78
105 0.78
106 0.72