Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GD59

Protein Details
Accession A0A2I1GD59    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-56STLLIPQNKLKRKKQKRIEWTQEELHydrophilic
83-109NRTNVQLKDKARNEKRRREREGIPLGIHydrophilic
NLS Segment(s)
PositionSequence
41-47LKRKKQK
92-102KARNEKRRRER
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
Amino Acid Sequences MSDGQENNKISSSEDVLDESFHTNKTVTKRSSTLLIPQNKLKRKKQKRIEWTQEELEELEEGMEKFGTNWTLILNMSSGPLKNRTNVQLKDKARNEKRRREREGIPLGIFQKATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.17
5 0.17
6 0.16
7 0.15
8 0.14
9 0.14
10 0.13
11 0.17
12 0.23
13 0.3
14 0.3
15 0.33
16 0.35
17 0.35
18 0.39
19 0.36
20 0.37
21 0.37
22 0.41
23 0.4
24 0.45
25 0.51
26 0.56
27 0.62
28 0.64
29 0.67
30 0.71
31 0.79
32 0.82
33 0.84
34 0.87
35 0.9
36 0.9
37 0.86
38 0.79
39 0.71
40 0.61
41 0.51
42 0.4
43 0.29
44 0.19
45 0.12
46 0.07
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.05
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.07
64 0.07
65 0.08
66 0.09
67 0.15
68 0.16
69 0.18
70 0.22
71 0.28
72 0.36
73 0.41
74 0.46
75 0.5
76 0.53
77 0.61
78 0.64
79 0.68
80 0.7
81 0.76
82 0.78
83 0.8
84 0.87
85 0.87
86 0.89
87 0.85
88 0.82
89 0.81
90 0.81
91 0.76
92 0.67
93 0.61
94 0.54
95 0.49