Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FYP6

Protein Details
Accession A0A2I1FYP6    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-39QLLAPCKKTRGKKGRITRPQNAFIHydrophilic
NLS Segment(s)
PositionSequence
26-28GKK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MVQEGFTFPTHIPLEQLLAPCKKTRGKKGRITRPQNAFILYRKDLQDKIKDENPDADFKEISRIAGNRWKHEVDHVKNNYTLLATLGGLVHQDLFPNYKYQPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.23
4 0.22
5 0.24
6 0.25
7 0.26
8 0.31
9 0.35
10 0.41
11 0.49
12 0.54
13 0.61
14 0.69
15 0.78
16 0.84
17 0.87
18 0.88
19 0.85
20 0.82
21 0.77
22 0.69
23 0.6
24 0.51
25 0.44
26 0.42
27 0.34
28 0.31
29 0.27
30 0.28
31 0.29
32 0.31
33 0.35
34 0.31
35 0.35
36 0.35
37 0.35
38 0.33
39 0.35
40 0.32
41 0.28
42 0.26
43 0.23
44 0.19
45 0.17
46 0.21
47 0.16
48 0.15
49 0.14
50 0.14
51 0.16
52 0.23
53 0.26
54 0.24
55 0.29
56 0.29
57 0.27
58 0.35
59 0.42
60 0.41
61 0.49
62 0.49
63 0.47
64 0.47
65 0.47
66 0.39
67 0.29
68 0.24
69 0.15
70 0.12
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.06
79 0.07
80 0.08
81 0.11
82 0.12
83 0.16