Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HMK9

Protein Details
Accession A0A2I1HMK9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
165-201KEKGKEELEKENRKKNKRKKGKLSKKKEGEKEGRIELBasic
NLS Segment(s)
PositionSequence
167-202KGKEELEKENRKKNKRKKGKLSKKKEGEKEGRIELR
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
Gene Ontology GO:0008237  F:metallopeptidase activity  
Amino Acid Sequences MTSAMKVISKVCLFRFVIKTYQPDTSPMLELSVIKDLQNHQYPKGSAMHELIHTLRRFGFYHEYQYYRPDRNEYLTVIAKVDDDGMRSQKRKEQVPRIVSYSQLRLITNIFSQFMPTFKFTYAIKALKALYLSSSYLPTLRKEFKENERLLFLIFFVYLNEDLEKEKGKEELEKENRKKNKRKKGKLSKKKEGEKEGRIELRKLNSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.38
4 0.41
5 0.42
6 0.46
7 0.42
8 0.45
9 0.38
10 0.37
11 0.37
12 0.33
13 0.31
14 0.25
15 0.23
16 0.19
17 0.19
18 0.18
19 0.18
20 0.16
21 0.14
22 0.17
23 0.18
24 0.25
25 0.32
26 0.32
27 0.3
28 0.35
29 0.36
30 0.36
31 0.39
32 0.32
33 0.27
34 0.27
35 0.26
36 0.21
37 0.23
38 0.21
39 0.23
40 0.22
41 0.21
42 0.19
43 0.2
44 0.2
45 0.22
46 0.28
47 0.23
48 0.31
49 0.33
50 0.35
51 0.33
52 0.39
53 0.4
54 0.37
55 0.36
56 0.33
57 0.31
58 0.33
59 0.34
60 0.29
61 0.28
62 0.26
63 0.25
64 0.21
65 0.19
66 0.15
67 0.13
68 0.13
69 0.09
70 0.08
71 0.09
72 0.14
73 0.18
74 0.19
75 0.21
76 0.23
77 0.28
78 0.34
79 0.41
80 0.46
81 0.51
82 0.55
83 0.56
84 0.57
85 0.52
86 0.47
87 0.4
88 0.32
89 0.26
90 0.22
91 0.2
92 0.16
93 0.16
94 0.15
95 0.14
96 0.12
97 0.11
98 0.09
99 0.1
100 0.1
101 0.1
102 0.11
103 0.12
104 0.12
105 0.11
106 0.13
107 0.12
108 0.17
109 0.21
110 0.2
111 0.19
112 0.2
113 0.2
114 0.19
115 0.19
116 0.15
117 0.11
118 0.11
119 0.12
120 0.1
121 0.11
122 0.1
123 0.12
124 0.14
125 0.15
126 0.19
127 0.23
128 0.25
129 0.29
130 0.35
131 0.41
132 0.5
133 0.5
134 0.46
135 0.43
136 0.41
137 0.37
138 0.31
139 0.22
140 0.13
141 0.11
142 0.08
143 0.06
144 0.08
145 0.08
146 0.09
147 0.09
148 0.09
149 0.1
150 0.12
151 0.15
152 0.14
153 0.15
154 0.16
155 0.17
156 0.23
157 0.25
158 0.34
159 0.41
160 0.52
161 0.57
162 0.65
163 0.73
164 0.77
165 0.85
166 0.85
167 0.86
168 0.87
169 0.91
170 0.93
171 0.95
172 0.96
173 0.96
174 0.96
175 0.96
176 0.95
177 0.94
178 0.92
179 0.91
180 0.89
181 0.86
182 0.82
183 0.8
184 0.78
185 0.71
186 0.65
187 0.6