Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HPH5

Protein Details
Accession A0A2I1HPH5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-102KVMGSKRKTKHRGPFNSNTCFKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7E.R. 7, plas 6, mito 3, golg 3
Family & Domain DBs
Amino Acid Sequences MKLSIPLTIVAIICIIALEQIEAFNTTLAISVFFSQCKVWATDNFSNIVMDTGWLNCEEGDPDPTYHIREITANPYWLHAKVMGSKRKTKHRGPFNSNTCFKFNGNVFKWGFDQYNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.07
11 0.06
12 0.06
13 0.06
14 0.07
15 0.07
16 0.07
17 0.06
18 0.08
19 0.09
20 0.09
21 0.1
22 0.09
23 0.11
24 0.12
25 0.13
26 0.14
27 0.16
28 0.24
29 0.27
30 0.28
31 0.28
32 0.26
33 0.24
34 0.22
35 0.19
36 0.1
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.08
48 0.08
49 0.08
50 0.1
51 0.11
52 0.12
53 0.12
54 0.11
55 0.1
56 0.11
57 0.12
58 0.16
59 0.18
60 0.18
61 0.17
62 0.19
63 0.2
64 0.19
65 0.18
66 0.15
67 0.14
68 0.2
69 0.28
70 0.34
71 0.37
72 0.45
73 0.5
74 0.6
75 0.66
76 0.68
77 0.69
78 0.73
79 0.78
80 0.8
81 0.84
82 0.81
83 0.83
84 0.79
85 0.73
86 0.65
87 0.57
88 0.49
89 0.45
90 0.42
91 0.43
92 0.41
93 0.45
94 0.43
95 0.42
96 0.44
97 0.41