Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GXX9

Protein Details
Accession A0A2I1GXX9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-72QVNRGGKNKKGGKNGKNGKSKKKSKKGWBasic
NLS Segment(s)
PositionSequence
48-72RGGKNKKGGKNGKNGKSKKKSKKGW
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MAVDEKIGQKRGNKDELSRGMVSSDGTEDDSESDISEPKVEVKEQVNRGGKNKKGGKNGKNGKSKKKSKKGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.56
4 0.55
5 0.47
6 0.4
7 0.32
8 0.3
9 0.26
10 0.17
11 0.13
12 0.08
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.06
25 0.07
26 0.08
27 0.08
28 0.11
29 0.14
30 0.21
31 0.24
32 0.32
33 0.37
34 0.38
35 0.44
36 0.49
37 0.49
38 0.51
39 0.58
40 0.57
41 0.61
42 0.69
43 0.7
44 0.73
45 0.8
46 0.8
47 0.81
48 0.82
49 0.83
50 0.84
51 0.87
52 0.88