Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G7Z5

Protein Details
Accession A0A2I1G7Z5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-72REKKHVSASWRKEKNKKTKTFCRFSYHydrophilic
91-110KITKGQKKRFDRFMKKEGCRBasic
NLS Segment(s)
PositionSequence
57-63RKEKNKK
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MNDKYKYSKFLESLFRIQDFIPSRARRKYFDRVCTLLIQQDKAVFAREKKHVSASWRKEKNKKTKTFCRFSYGYRGFYIDKSFTEPVPFVKITKGQKKRFDRFMKKEGCREFNKFTANSMATFCRHRIHKLIRLGTDGKNEEALELESRLNLQMAKIDDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.42
4 0.39
5 0.4
6 0.35
7 0.33
8 0.36
9 0.38
10 0.43
11 0.5
12 0.54
13 0.51
14 0.54
15 0.62
16 0.62
17 0.64
18 0.65
19 0.6
20 0.59
21 0.57
22 0.51
23 0.45
24 0.38
25 0.31
26 0.24
27 0.22
28 0.21
29 0.18
30 0.21
31 0.18
32 0.19
33 0.24
34 0.29
35 0.32
36 0.32
37 0.36
38 0.35
39 0.4
40 0.47
41 0.51
42 0.55
43 0.6
44 0.66
45 0.71
46 0.78
47 0.81
48 0.81
49 0.81
50 0.8
51 0.82
52 0.84
53 0.82
54 0.75
55 0.7
56 0.62
57 0.55
58 0.56
59 0.49
60 0.42
61 0.35
62 0.35
63 0.29
64 0.28
65 0.28
66 0.18
67 0.15
68 0.17
69 0.17
70 0.15
71 0.15
72 0.15
73 0.13
74 0.17
75 0.16
76 0.13
77 0.14
78 0.2
79 0.26
80 0.36
81 0.44
82 0.48
83 0.57
84 0.67
85 0.71
86 0.76
87 0.79
88 0.8
89 0.78
90 0.8
91 0.8
92 0.75
93 0.76
94 0.72
95 0.69
96 0.63
97 0.62
98 0.57
99 0.51
100 0.52
101 0.45
102 0.4
103 0.39
104 0.35
105 0.3
106 0.27
107 0.25
108 0.22
109 0.24
110 0.24
111 0.24
112 0.26
113 0.29
114 0.36
115 0.41
116 0.48
117 0.54
118 0.59
119 0.55
120 0.58
121 0.58
122 0.52
123 0.51
124 0.45
125 0.37
126 0.33
127 0.31
128 0.26
129 0.23
130 0.21
131 0.15
132 0.15
133 0.14
134 0.12
135 0.13
136 0.13
137 0.13
138 0.11
139 0.1
140 0.13