Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HUE2

Protein Details
Accession A0A2I1HUE2    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
51-72LFRRSMNNKRAHQKRLKKKETEBasic
143-179DVNVSGKSGKKKNERKKSGRISNQPRKDYNKNNKVSYHydrophilic
NLS Segment(s)
PositionSequence
57-79NNKRAHQKRLKKKETEVILKKNK
149-165KSGKKKNERKKSGRISN
Subcellular Location(s) nucl 23.5, cyto_nucl 13.333, cyto_mito 2.333
Family & Domain DBs
Amino Acid Sequences SSIRDLIEAYIDVETSWEKQERRAILKIIEKFKGNNSHFPKTTGDWAIKELFRRSMNNKRAHQKRLKKKETEVILKKNKSVITRNKIKNKVVINSSGTACSSGTADDLSDKSDNNDNNTDVDNTNTNVSSGKSGKKKNDNNTDVNVSGKSGKKKNERKKSGRISNQPRKDYNKNNKVSYLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.14
4 0.18
5 0.19
6 0.24
7 0.31
8 0.36
9 0.41
10 0.44
11 0.43
12 0.45
13 0.52
14 0.54
15 0.53
16 0.5
17 0.46
18 0.43
19 0.46
20 0.5
21 0.46
22 0.48
23 0.5
24 0.55
25 0.54
26 0.55
27 0.51
28 0.43
29 0.46
30 0.4
31 0.36
32 0.29
33 0.3
34 0.32
35 0.3
36 0.3
37 0.26
38 0.27
39 0.27
40 0.31
41 0.35
42 0.42
43 0.49
44 0.55
45 0.6
46 0.65
47 0.7
48 0.75
49 0.78
50 0.78
51 0.8
52 0.83
53 0.84
54 0.8
55 0.77
56 0.75
57 0.73
58 0.73
59 0.69
60 0.68
61 0.68
62 0.64
63 0.59
64 0.56
65 0.5
66 0.44
67 0.45
68 0.45
69 0.44
70 0.53
71 0.6
72 0.65
73 0.68
74 0.66
75 0.64
76 0.57
77 0.53
78 0.45
79 0.41
80 0.33
81 0.3
82 0.28
83 0.23
84 0.19
85 0.15
86 0.13
87 0.1
88 0.08
89 0.06
90 0.06
91 0.05
92 0.05
93 0.06
94 0.06
95 0.08
96 0.08
97 0.08
98 0.1
99 0.15
100 0.16
101 0.19
102 0.21
103 0.19
104 0.2
105 0.21
106 0.21
107 0.17
108 0.17
109 0.15
110 0.14
111 0.14
112 0.13
113 0.12
114 0.11
115 0.11
116 0.14
117 0.16
118 0.22
119 0.28
120 0.35
121 0.43
122 0.53
123 0.61
124 0.67
125 0.75
126 0.74
127 0.71
128 0.7
129 0.66
130 0.56
131 0.49
132 0.39
133 0.3
134 0.29
135 0.29
136 0.32
137 0.34
138 0.42
139 0.51
140 0.62
141 0.71
142 0.77
143 0.83
144 0.84
145 0.89
146 0.91
147 0.91
148 0.91
149 0.91
150 0.91
151 0.91
152 0.92
153 0.89
154 0.85
155 0.83
156 0.83
157 0.83
158 0.83
159 0.82
160 0.8
161 0.77